SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002879 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002879
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily HIT-like 1.21e-72
Family Hexose-1-phosphate uridylyltransferase 0.0000025
Further Details:      
 
Domain Number 2 Region: 199-367
Classification Level Classification E-value
Superfamily HIT-like 4.71e-52
Family Hexose-1-phosphate uridylyltransferase 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002879   Gene: ENSGGOG00000002927   Transcript: ENSGGOT00000002944
Sequence length 379
Comment pep:known_by_projection chromosome:gorGor3.1:9:35331963:35335901:1 gene:ENSGGOG00000002927 transcript:ENSGGOT00000002944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQ
LLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAK
SARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWASVTEELGAQYPWVQIFENKGAMMGC
SNPHPHCQVWASSFLPDIAQREERSQQAYKSQHGEPLLMEYSHQELLRKERLVLTSEHWL
VLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGW
HGAPTGSEAGANWDHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRA
LPEVHYRLGQKDRETATIA
Download sequence
Identical sequences G3QKA8
XP_004048011.1.27298 ENSGGOP00000002879 ENSGGOP00000002879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]