SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002930 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002930
Domain Number 1 Region: 162-281
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 284-366
Classification Level Classification E-value
Superfamily C-type lectin-like 4.24e-24
Family Link domain 0.0038
Further Details:      
 
Domain Number 3 Region: 48-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000245
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002930   Gene: ENSGGOG00000002981   Transcript: ENSGGOT00000002996
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:19:19637361:19644446:-1 gene:ENSGGOG00000002981 transcript:ENSGGOT00000002996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHR
GGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQG
DGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAE
AQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSSG
GRGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV
AKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFG
VYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLRV
Download sequence
Identical sequences G3QKF6
ENSGGOP00000002930 ENSGGOP00000002930 XP_004060407.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]