SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002933 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002933
Domain Number 1 Region: 1573-1686
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000273
Further Details:      
 
Domain Number 2 Region: 1467-1572
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002933   Gene: ENSGGOG00000002973   Transcript: ENSGGOT00000002999
Sequence length 1688
Comment pep:known_by_projection chromosome:gorGor3.1:X:105550460:105835578:-1 gene:ENSGGOG00000002973 transcript:ENSGGOT00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINKLWLLLVTLCLTEELAGAGEKFYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGP
TGPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLD
GITGPQGAPGSPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGIPGLPGPRG
PMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGD
PGVPGLPGLKGDEGIQGVRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAA
GLPGRDGLPGPPGPPGPPSPEFETETLHNKEPGFPGLRGEQGPKGNLGLKGIKGDSGFCA
CDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKG
KKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGL
PGLPGETGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSY
GPSGFPGTPGFPGPKGSRGLPGIPGQPGSSGTKGEPGSRGLVHLPELPGFPGPRGEKGLP
GFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPG
LKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGTSGHPG
KKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVG
FVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMS
NLWLKGDKGSQGSAGSNGFPGPRGDKGDAGRPGPPGLPGAPGLPGIIKGVSGNPGPPGFM
GIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGP
KGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMKGEPGL
PGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLP
GPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGR
PGLDGERGHPGPPGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGFPGELGL
KGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGPLG
LPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPG
FEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEK
AHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQ
YISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGS
CLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSR
CQVCMKSL
Download sequence
Identical sequences G3QKF9
ENSGGOP00000002933 ENSGGOP00000026938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]