SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002947 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000002947
Domain Number - Region: 49-93
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0968
Family Apolipoprotein A-I 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002947   Gene: ENSGGOG00000011747   Transcript: ENSGGOT00000003013
Sequence length 352
Comment pep:novel chromosome:gorGor3.1:6:168722884:168739282:-1 gene:ENSGGOG00000011747 transcript:ENSGGOT00000003013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGQLEAGEPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDGNAREMPSLQQQITRLHQE
LGRQQSLWADVHRKLQSHMDALRKQNRELREELGLQQQQWEAGKKPAASPHAGRESHTPA
LEPAFGKISPLSADEETTPKYAGRKSQSATLLGQRSSSNHFAPPKPMSLKTERINSGKTR
PQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKVMHPSSRSPQNSSGRKSPAQAS
QAATLQEQTAAAGGADRSSSVLGSSEGEFLSHVQADEFATSSPDSAEQQNLPVNPPSSLE
IAQAMDTKMKKEEVQEEKRHPNGKADDCRRSGFPSEFPGALHAAPSRQVMGP
Download sequence
Identical sequences ENSGGOP00000002947 ENSGGOP00000011463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]