SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002950 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002950
Domain Number 1 Region: 42-309
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.94e-65
Family Glycerophosphoryl diester phosphodiesterase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002950   Gene: ENSGGOG00000003001   Transcript: ENSGGOT00000003016
Sequence length 314
Comment pep:known_by_projection chromosome:gorGor3.1:5:24598584:24650478:-1 gene:ENSGGOG00000003001 transcript:ENSGGOT00000003016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAF
QHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF
QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGN
ANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKE
PHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTD
YPTKLRDFLHNFSA
Download sequence
Identical sequences A0A2I2YEU8 H2QDK1 Q8N9F7
ENSP00000462895 ENSPTRP00000016072 gi|260763876|ref|NP_872375.2| ENSGGOP00000002950 ENSPTRP00000016072 ENSP00000284116 ENSGGOP00000002950 9598.ENSPTRP00000016073 9606.ENSP00000284116 NP_872375.2.87134 NP_872375.2.92137 XP_018882144.1.27298 XP_511917.5.37143 ENSP00000284116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]