SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002953 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002953
Domain Number 1 Region: 213-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.58e-50
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily POZ domain 1.05e-25
Family Tetramerization domain of potassium channels 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002953   Gene: ENSGGOG00000003005   Transcript: ENSGGOT00000003019
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:20:42892653:42897048:-1 gene:ENSGGOG00000003005 transcript:ENSGGOT00000003019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLLVRGTHYENLRSKVVLPTPLAGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR
RQLSARALARFPGTRLGRLHAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST
GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHR
EFEDLLSSVDGVSEASLETSRETSQEGRSADLESQAPSEPPHPQRY
Download sequence
Identical sequences A0A2I2YND0
ENSGGOP00000002953 XP_018873128.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]