SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002957 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002957
Domain Number 1 Region: 129-411
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-68
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000000144
Further Details:      
 
Domain Number 2 Region: 73-142
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000335
Family Ubiquitin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002957   Gene: ENSGGOG00000003003   Transcript: ENSGGOT00000003023
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:18:111895:160168:1 gene:ENSGGOG00000003003 transcript:ENSGGOT00000003023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVSSLQSLRSCTGVLRVAASSPVAGLNETRRTEAAATTAPPPRPPPQLLLVPVPLPPLSG
PALLRRRLPPRPAMPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVM
VKGGTLKMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYIT
AALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQ
KLEAIEDDSVKETDSSSASVATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQL
QLSCFINQEVKYLFTGLKLSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGR
SSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIME
EESE
Download sequence
Identical sequences ENSGGOP00000002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]