SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002978 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002978
Domain Number 1 Region: 49-277,308-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-38
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002978   Gene: ENSGGOG00000003027   Transcript: ENSGGOT00000003044
Sequence length 464
Comment pep:known_by_projection chromosome:gorGor3.1:14:31085720:31152668:-1 gene:ENSGGOG00000003027 transcript:ENSGGOT00000003044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLVGACGRARGSFAGGSPGACGFASGRPRRLCGGSRSASSSSFDIVIVGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKKLIVAVEQEEIPRLQALYEKGLQNGVQGLRLIQQEDIKKKEPYC
RGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKDIEMAKESPSRSIDGMQYP
IVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGN
IYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIK
LASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDF
VFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Download sequence
Identical sequences ENSGGOP00000002978 ENSGGOP00000002978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]