SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002979 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002979
Domain Number 1 Region: 53-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-30
Family G proteins 0.047
Further Details:      
 
Domain Number 2 Region: 443-531
Classification Level Classification E-value
Superfamily EF-hand 1e-22
Family Eps15 homology domain (EH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002979   Gene: ENSGGOG00000003031   Transcript: ENSGGOT00000003045
Sequence length 535
Comment pep:known_by_projection chromosome:gorGor3.1:2a:31803827:31840110:1 gene:ENSGGOG00000003031 transcript:ENSGGOT00000003045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKK
PFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSL
GKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQ
DQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHG
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSV
LGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE
Download sequence
Identical sequences G3QKK4 H2QHQ1
ENSPTRP00000020273 ENSGGOP00000002979 ENSGGOP00000002979 ENSNLEP00000018879 9598.ENSPTRP00000020273 ENSPTRP00000020273 XP_003262753.1.23891 XP_003827209.1.60992 XP_004029115.1.27298 XP_515386.2.37143 ENSNLEP00000018879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]