SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002980
Domain Number 1 Region: 280-516
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-63
Family Nuclear receptor ligand-binding domain 0.000000000619
Further Details:      
 
Domain Number 2 Region: 165-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002980   Gene: ENSGGOG00000003030   Transcript: ENSGGOT00000003046
Sequence length 548
Comment pep:known_by_projection chromosome:gorGor3.1:14:45223517:45285960:-1 gene:ENSGGOG00000003030 transcript:ENSGGOT00000003046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NDLCASSCKVFSQLLSQDMDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHE
YPAMTFYSPAVMNYSIPSNVTSLEGGPGRQTTSPNVLWPTPGHLSPLAVHRQLSHLYAEP
QKSPWCEARSLEHTLPVNRETLKRKVSGNRCTSPVTGPSSKRDAHFCAVCSDYASGYHYG
VWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRE
RCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLI
SRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMVG
LMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKA
MILLNSSMYPLVAATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLL
SHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKE
GSQNPQSQ
Download sequence
Identical sequences ENSGGOP00000002980 ENSGGOP00000002980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]