SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002982
Domain Number 1 Region: 483-656
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 638-735
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.96e-18
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 802-947
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000036
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002982   Gene: ENSGGOG00000003028   Transcript: ENSGGOT00000003048
Sequence length 1254
Comment pep:known_by_projection chromosome:gorGor3.1:5:164422056:164467855:-1 gene:ENSGGOG00000003028 transcript:ENSGGOT00000003048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRAAGLGRLLVGTLDVVLDSSARVAPYR
ILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIA
EENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVN
HLCFYSFLLGKEGTVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETF
KLMEQLANLAMRQLLDSEGFLEDKALPRPIRPHRNISALKRDLDARAKNECYRATFRLPR
DERLDGHTSCTLWTPFNKLHIAGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSS
SVLPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASAVDPSTE
SSPAPQEVSEQPASPASPLSSRQSFCVQEVPTASQGLLKLFQKNSPMEDLGAKGAKEKMK
EESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAEL
VEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNI
VTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSEKMQ
DLGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCS
DEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSGDDPPAEVDIFELLKVSYEKFSSLR
AEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWG
CSRTMAGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSL
INFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPGTALSPEEAESALEAAHYFTEDSSSEAS
PLASDLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRHYLRMWAKEKEAQKETI
KDLPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKKFSARTGRKP
RDCATEEDEPPAPELHQDAARELQPPAAGDPQAKAGGDTHLGKAPQESQVVVEGGSGEGR
GSPSQLLSDDETKDDMSMSSYSVVSTGSLQCEDLADDTVLVGGEAGSPTARIGGTVDTDW
CISFEQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGVSG
Download sequence
Identical sequences ENSGGOP00000027849 ENSGGOP00000002982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]