SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002997 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002997
Domain Number 1 Region: 70-147
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000114
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002997
Domain Number - Region: 206-301
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000732
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002997   Gene: ENSGGOG00000003047   Transcript: ENSGGOT00000003064
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:11:105462262:105489158:-1 gene:ENSGGOG00000003047 transcript:ENSGGOT00000003064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSRNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAF
RSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLLDCFGIPVLMALSW
FILHARYRVIHFIAVAVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAISN
VCEEYIVKKLSRQEFLGMVGLFGTVISGIQLLIVEYKDIASIHWDWKIALLFVAFALCMF
CLYSFMPLVIKVTSATSVNLGILTADLYSLFVGLFLFGYKFSGLYILSFTVIMVGFILYC
STPTRTAEPTESSVPPVTSIGIDNLGLKLEENLQETHSAVL
Download sequence
Identical sequences ENSGGOP00000002997 ENSGGOP00000002997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]