SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003004 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003004
Domain Number 1 Region: 8-81,226-346,753-876
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.14e-45
Family Calcium ATPase, transmembrane domain M 0.031
Further Details:      
 
Domain Number 2 Region: 340-364,511-620,668-748
Classification Level Classification E-value
Superfamily HAD-like 8.65e-34
Family Meta-cation ATPase, catalytic domain P 0.045
Further Details:      
 
Domain Number 3 Region: 358-571
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.83e-25
Family Metal cation-transporting ATPase, ATP-binding domain N 0.005
Further Details:      
 
Domain Number 4 Region: 78-148,184-224
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.58e-21
Family Calcium ATPase, transduction domain A 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003004   Gene: ENSGGOG00000003045   Transcript: ENSGGOT00000003071
Sequence length 997
Comment pep:novel chromosome:gorGor3.1:13:7288395:7801797:1 gene:ENSGGOG00000003045 transcript:ENSGGOT00000003071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIIILTIAGIK
EIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVNGQYLPADVVLLSSS
EPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIECEGPNRHLYDFTGNL
NLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTN
VQILVLFGILLVMALVSSAGALYWNRSHGEKNWYIKKMDTTSDNFGYNLLTFIILYNNLI
PISLLVTLEVVKYTQALFINWDTDMYYIGNDTPAMARTSNLNEELGQVKYLFSDKTGTLT
CNIMNFKKCSIAGVTYPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAALVKGA
KKLGFVFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGAD
NVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKD
RAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINI
GYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSF
EVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVKAITLAIGDGANDVGMIQTAHVG
VGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELW
FAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKITQNGEG
FNTKVFWGHCINALVHSLILFWFPMKALEHATMVLSSAHFWLGLFLVPTACLIEDVAWRA
AKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSL
QQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK
Download sequence
Identical sequences ENSGGOP00000003004 ENSGGOP00000003004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]