SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003012 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003012
Domain Number 1 Region: 637-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-45
Family Toll/Interleukin receptor TIR domain 0.0000000465
Further Details:      
 
Domain Number 2 Region: 45-166,354-554
Classification Level Classification E-value
Superfamily RNI-like 3.84e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.033
Further Details:      
 
Domain Number 3 Region: 143-235
Classification Level Classification E-value
Superfamily L domain-like 0.000000794
Family Internalin LRR domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003012
Domain Number - Region: 592-653
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.000161
Family Fumarate reductase respiratory complex cytochrome b subunit, FrdC 0.093
Further Details:      
 
Domain Number - Region: 226-402
Classification Level Classification E-value
Superfamily L domain-like 0.000231
Family Internalin LRR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003012   Gene: ENSGGOG00000003066   Transcript: ENSGGOT00000003080
Sequence length 784
Comment pep:known_by_projection chromosome:gorGor3.1:4:163991043:163993551:1 gene:ENSGGOG00000003066 transcript:ENSGGOT00000003080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHLLLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPVLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
Download sequence
Identical sequences ENSGGOP00000003012 ENSGGOP00000003012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]