SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003013 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003013
Domain Number 1 Region: 412-608
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-48
Family cAMP-binding domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 166-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-37
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003013   Gene: ENSGGOG00000003067   Transcript: ENSGGOT00000003081
Sequence length 698
Comment pep:known_by_projection chromosome:gorGor3.1:2a:95765907:95785413:1 gene:ENSGGOG00000003067 transcript:ENSGGOT00000003081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRGLADSGQGSFTGQGIARSGRIQKKSQPEKVVRAASRGRPLIGWTQWCAEDGGDESE
IALAGSPRCSSGPQGRLSRLIFLLRRWAARHVHHQDQGPNSFPDRFRGGELKEVSSQESN
AQANVGSQEPADRGRSTWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIA
LPVFYNWCLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDT
NRLWQHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTN
YPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSL
YWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAK
IDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDT
LKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVT
QFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKK
ALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQM
KMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
Download sequence
Identical sequences ENSGGOP00000022765 ENSGGOP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]