SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003021 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003021
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-30
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003021   Gene: ENSGGOG00000003076   Transcript: ENSGGOT00000003089
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:11:109307376:109327986:1 gene:ENSGGOG00000003076 transcript:ENSGGOT00000003089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSR
RLNFEEAKEACRRDGGQLVSIESEDEQKLVEKFIENLLPSDGDFWIGLRRREEKQSNSTA
CQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKN
NFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESREAALNLAYILIPG
IPLLLLLVVTTVVCWVWICRRRKWEQPDPSTKKQHTIWPSPPQGNSPDLEVYNVIRKQSE
ADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFVTLVSVESGFVTNDIYE
FSPDQMGRSKESGWVENEIYGY
Download sequence
Identical sequences ENSGGOP00000003021 ENSGGOP00000003021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]