SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003024 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003024
Domain Number 1 Region: 40-66,182-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.35e-43
Family G proteins 0.000016
Further Details:      
 
Domain Number 2 Region: 70-189
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.79e-41
Family Transducin (alpha subunit), insertion domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003024   Gene: ENSGGOG00000003077   Transcript: ENSGGOT00000003092
Sequence length 300
Comment pep:known_by_projection chromosome:gorGor3.1:19:3195668:3217176:1 gene:ENSGGOG00000003077 transcript:ENSGGOT00000003092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
Download sequence
Identical sequences ENSGGOP00000003024 ENSGGOP00000003024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]