SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003031 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003031
Domain Number 1 Region: 37-383
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.88e-129
Family Calpain large subunit, catalytic domain (domain II) 0.00000000312
Further Details:      
 
Domain Number 2 Region: 390-550
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.7e-51
Family Calpain large subunit, middle domain (domain III) 0.00000267
Further Details:      
 
Domain Number 3 Region: 565-737
Classification Level Classification E-value
Superfamily EF-hand 2.28e-43
Family Penta-EF-hand proteins 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003031   Gene: ENSGGOG00000003079   Transcript: ENSGGOT00000003099
Sequence length 739
Comment pep:known_by_projection chromosome:gorGor3.1:6:45489468:45513879:1 gene:ENSGGOG00000003079 transcript:ENSGGOT00000003099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYSPGPSLPESAESLDGSQEDKPRGSCAEPTFTDMGMVAHINNSRLKAKGVGQHDNAQN
FGNQSFEELRAACLRKGELFEDPLFPAEPSSLGFKDLGPNSKNVQNISWQRPKDIISDPL
FIMDGISPTDICQGILGDCWLLAAIGSLTSVPKLLYRVVPRGQSFKKNYAGIFHFQIWQF
GQWVNVVVDDRLPTKNDKLVFVHSTKRSEFWSALLEKAYAKLSGSYEALSGGSTMEGLED
FTGGVAQSFQLQRPPQNLLRLLRKAVERSSLMGCSIEVTSDSELESMTDKMLVRGHAYSV
TGLQDVHYRGKMETLLRVRNPWGWIGWNGAWSDSAREWEEVASDIQMQLLHKTEDREFWM
SYQDFLNNFTLLEICNLTPDTLSGDYKSYWHTTFYEGSWRRGSSAGGCRNHPGTFRTNPQ
FKISLPEGDDPEDDAEGNVVVCTCLVALMQKNWWHARQQGAQLQTIGFVLYSVPKEFQNI
QDVHLKKEFFTKYQDHGFSEIFANSREVSSQLRLPPGEYIIIPSTFEPHRDADFLLRVFT
EKHSESWELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAI
KFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTL
NSYEMRLAIEKAGIKLNNKVMQVLVARYADDDLIIDFDSFISCFLRLKTMFTFFLTMDPK
NTGHICLNLEQWLQMTMWG
Download sequence
Identical sequences ENSGGOP00000019099 ENSGGOP00000003031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]