SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003040 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003040
Domain Number 1 Region: 100-217
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.53e-50
Family Latexin-like 0.000000365
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.06e-36
Family Latexin-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003040   Gene: ENSGGOG00000003092   Transcript: ENSGGOT00000003108
Sequence length 222
Comment pep:known_by_projection chromosome:gorGor3.1:3:159403914:159410179:-1 gene:ENSGGOG00000003092 transcript:ENSGGOT00000003108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEDDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Download sequence
Identical sequences G3QKQ9
XP_004037964.1.27298 ENSGGOP00000003040 ENSGGOP00000003040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]