SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003057 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003057
Domain Number 1 Region: 635-886
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.19e-73
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000189
Further Details:      
 
Domain Number 2 Region: 188-330
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-39
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 86-190
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-37
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 484-578
Classification Level Classification E-value
Superfamily PDZ domain-like 8.12e-21
Family PDZ domain 0.00000879
Further Details:      
 
Domain Number 5 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.13e-20
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003057   Gene: ENSGGOG00000003104   Transcript: ENSGGOT00000003125
Sequence length 900
Comment pep:known_by_projection chromosome:gorGor3.1:2b:6696272:6812840:1 gene:ENSGGOG00000003104 transcript:ENSGGOT00000003125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTCEVFFLNQVIGMETVTKKHDQGQVLLDVVFKHLDLTEQDYFGLQLADDSTDNPRWLDP
NKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPSNTAA
LLASFAVQSELGDYDQSENLPGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNY
LNTARTLELYGVEFHYARDQSNNEIMIGVMSGGILIYKNRVRMNTFPWLKIVKISFKCKQ
FFIQLRKELHESRETLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTL
GSKFRYCGRTEVQSVQYGKEKANKDRVFASRSPSKPLARKLMDWEVVSRNSISDDRLETQ
SLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSI
VLESSPSQETPGDGKPPALPPKQSKKNSWNQIHYSHSQQDLESHINETFDIPSSPEKPTP
NGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQV
VLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNEVIDIFSNVAKNTSSLQRLYQP
NLFKLVNLKTEEFSFANLVQYSTRLCIETSLVNKRQLYRKKPGMTMSCAKLPQNISKNRY
RDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQG
SSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKN
ESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCRYGLSILGHIFFL
QTHIMSDCLQPIVEITVLKSLHPAKKLFLNFQSQYRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences ENSGGOP00000003057 ENSGGOP00000003057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]