SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003074 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003074
Domain Number 1 Region: 15-172
Classification Level Classification E-value
Superfamily EF-hand 2.23e-42
Family Calmodulin-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003074   Gene: ENSGGOG00000003125   Transcript: ENSGGOT00000003142
Sequence length 173
Comment pep:known_by_projection chromosome:gorGor3.1:19:45282877:45297269:-1 gene:ENSGGOG00000003125 transcript:ENSGGOT00000003142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTM
GYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTN
GDGEITLAELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR
Download sequence
Identical sequences A0A2J8U7B4 A0A2K5N132 A0A2K5R4L6 A0A2K6BCP6 A0A2K6MXL7 A0A2K6RAJ9 F7EMB5 G3QKT9 H2R5Y0
ENSGGOP00000003074 XP_003814151.1.60992 XP_004061123.1.27298 XP_010375687.1.97406 XP_011734420.1.29376 XP_011936091.1.92194 XP_014979854.1.72884 XP_017744665.1.44346 ENSGGOP00000003074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]