SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003151 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003151
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily Folate-binding domain 1.05e-84
Family Aminomethyltransferase folate-binding domain 0.0000276
Further Details:      
 
Domain Number 2 Region: 52-265,376-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-58
Family FAD-linked reductases, N-terminal domain 0.00039
Further Details:      
 
Domain Number 3 Region: 265-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.45e-29
Family L-aminoacid/polyamine oxidase 0.007
Further Details:      
 
Domain Number 4 Region: 769-855
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.03e-22
Family Aminomethyltransferase beta-barrel domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003151   Gene: ENSGGOG00000003203   Transcript: ENSGGOT00000003223
Sequence length 866
Comment pep:known_by_projection chromosome:gorGor3.1:17:18597813:18668779:1 gene:ENSGGOG00000003203 transcript:ENSGGOT00000003223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPGAQLLRGLLLRSCPLLGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCV
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYLIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKARSDGTWDVETPQGSMR
ANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYL
RQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDRIMEHIKAAMEMVPVLK
KADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVGVTDLSPFGKF
NIKGQDSIRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTISHQSPGEFLLITGSGSE
LHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTK
SLKVSNIPVTAIRISYTGELGWELYHRREDSVALYDAIMNAGQEEGIDNFGTYAMNALRL
EKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATD
DVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPA
VIIQEPLVLTEPTRNRLQKKGGKDKT
Download sequence
Identical sequences G3QL10
ENSGGOP00000003151 XP_004058698.1.27298 ENSGGOP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]