SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003164 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003164
Domain Number 1 Region: 250-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000144
Family SOCS box-like 0.0042
Further Details:      
 
Domain Number 2 Region: 92-171
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000533
Family Ankyrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003164   Gene: ENSGGOG00000003221   Transcript: ENSGGOT00000003236
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:1:78150042:78163642:-1 gene:ENSGGOG00000003221 transcript:ENSGGOT00000003236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSTKLCRKTSCPRSNIFCNLLDKIVKRPSLQFLGQWGYHCYEPRIYRSLAKILRYVDL
DGFDALLTDYIAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKD
YVQDRSCNLALIWRTFTPVYCPSPLSGITPLFYVAQTRQSNIFKILLQYGILEREKNPIN
IVLTIVLYPSRVRVMVDRELADIHEDAKTCLVLCSRVLSVISVKEIKTQLSLGRHPIISN
WFDYIPSTRYKDPCELLHLCRLTIRNQLLTNNMLPDGIFSLLIPARLQNYLNLEI
Download sequence
Identical sequences G3QL23 H2R8Z0
ENSGGOP00000003164 ENSPTRP00000052167 XP_004026047.1.27298 XP_008954274.1.60992 XP_513502.2.37143 ENSPTRP00000052167 ENSGGOP00000003164 9598.ENSPTRP00000052167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]