SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003197 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003197
Domain Number 1 Region: 178-332
Classification Level Classification E-value
Superfamily CBS-domain pair 4.64e-41
Family CBS-domain pair 0.000000367
Further Details:      
 
Domain Number 2 Region: 343-481
Classification Level Classification E-value
Superfamily CBS-domain pair 7.46e-31
Family CBS-domain pair 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003197   Gene: ENSGGOG00000003249   Transcript: ENSGGOT00000003270
Sequence length 489
Comment pep:known_by_projection chromosome:gorGor3.1:2b:107770625:107780023:-1 gene:ENSGGOG00000003249 transcript:ENSGGOT00000003270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKASRW
TRQKAVEEGEPPGQGEGPRSRPAAESTRLEATFPKATPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLVEERPAPCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLEPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
Download sequence
Identical sequences G3QL54
ENSGGOP00000003197 ENSGGOP00000003197 XP_004033271.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]