SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003210 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003210
Domain Number 1 Region: 189-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-59
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 35-144
Classification Level Classification E-value
Superfamily POZ domain 4.45e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003210   Gene: ENSGGOG00000003267   Transcript: ENSGGOT00000003283
Sequence length 911
Comment pep:known_by_projection chromosome:gorGor3.1:8:70945875:71319029:1 gene:ENSGGOG00000003267 transcript:ENSGGOT00000003283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
LGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFG
QELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLW
DLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQLNDNRQLAHVEAVC
IAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV
QIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDE
DATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANTKD
SADDNHLSPSRWKWARKALSETSSNKSFENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKL
EMLYNEITKTQPHSHPNPDCQEKPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKST
SSIDSFTSCATDFTETERSPLPPPSASHLQMKFPTDLPGTEEHQRARGPPFLTLSREKGP
AARDGMLEYAPVDMTVNLDASGSQCGLHSPLQSDNATDSPKSSLKGSNPLKSRSLKVNFK
ENRGSAPQTPPSTARPLPVTTADFSLTTPQHISTILLEETPSQGDRPLLGTEVSAPCQGP
SKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELPGAREEKQVDSSPNCFADKPSN
GRDPLREEGSMGSSSPQDTGHNCRQDIYHAVSEVKKDSSQEGCKMENHLFAPEIHSNPGD
TGYCPTRETSM
Download sequence
Identical sequences G3QL66
XP_004047193.1.27298 ENSGGOP00000003210 ENSGGOP00000003210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]