SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003216 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003216
Domain Number 1 Region: 61-176
Classification Level Classification E-value
Superfamily EF-hand 9.34e-28
Family Calmodulin-like 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003216   Gene: ENSGGOG00000003277   Transcript: ENSGGOT00000003289
Sequence length 224
Comment pep:known_by_projection chromosome:gorGor3.1:12:54187454:54189289:1 gene:ENSGGOG00000003277 transcript:ENSGGOT00000003289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEAGKGD
QNSFRVERGMGWARKKTGQISRASRRITVLQVVGRRLRRSELWG
Download sequence
Identical sequences ENSGGOP00000025434 ENSGGOP00000003216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]