SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003249 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003249
Domain Number 1 Region: 182-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.58e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000414
Further Details:      
 
Domain Number 2 Region: 28-78,125-239
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000000000224
Family N-terminal domain of adrenodoxin reductase-like 0.0000531
Further Details:      
 
Domain Number 3 Region: 374-533
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000789
Family N-terminal domain of adrenodoxin reductase-like 0.000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003249   Gene: ENSGGOG00000003306   Transcript: ENSGGOT00000003323
Sequence length 534
Comment pep:known_by_projection chromosome:gorGor3.1:5:8410572:8421092:1 gene:ENSGGOG00000003306 transcript:ENSGGOT00000003323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFRHHFSTQEKTPQICVVGSGPAGFYTAQHLLKR
VEALCSQPRVLNSPALSGEGEDLGASQPLSLGPTSCHPVPQQHPQAHVDIYEKQPVPFGL
VRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAED
HRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLT
PPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPV
DFLGLQDKIKEVPRPRKRLTELLLRTATEKPGLEEAARQASASRAWGLRFFRSPQQVLPS
PDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKL
GVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPG
YAAIQALLSSRGVRPVSFSEWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences ENSGGOP00000003249 ENSGGOP00000003249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]