SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003265 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003265
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily L domain-like 4.17e-50
Family Internalin LRR domain 0.037
Further Details:      
 
Domain Number 2 Region: 190-393
Classification Level Classification E-value
Superfamily L domain-like 7.25e-37
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003265   Gene: ENSGGOG00000003320   Transcript: ENSGGOT00000003339
Sequence length 524
Comment pep:known_by_projection chromosome:gorGor3.1:6:55303628:55438451:1 gene:ENSGGOG00000003320 transcript:ENSGGOT00000003339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHCIPLWRCNRHVESIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVK
LRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRL
PESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELD
LGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS
GLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGDCESLTELVLTENQ
LLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATEL
HVLDVAGNRLLHLPLSLTALKLKALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLPQLP
SEPTCQENLPRCGALENLVNDVSDEAWNERAVNRVSAIRFVEDEKDEEDNETRTLLRRAT
PHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTTSV
Download sequence
Identical sequences G3QLB7 H2PJE6 H2QT79
XP_001156152.1.37143 XP_002817063.1.23681 XP_003828986.1.60992 XP_004044270.1.27298 ENSPTRP00000031252 ENSPPYP00000018709 ENSPTRP00000031252 ENSGGOP00000003265 9598.ENSPTRP00000031252 9600.ENSPPYP00000018709 ENSGGOP00000003265 ENSPPYP00000018709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]