SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003299 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003299
Domain Number 1 Region: 23-103
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.83e-24
Family Interleukin 8-like chemokines 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003299   Gene: ENSGGOG00000003356   Transcript: ENSGGOT00000003374
Sequence length 107
Comment pep:known_by_projection chromosome:gorGor3.1:4:82453771:82455615:1 gene:ENSGGOG00000003356 transcript:ENSGGOT00000003374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Download sequence
Identical sequences G3QLE9 H2QPN5 P09341
NP_001502.1.87134 NP_001502.1.92137 XP_001156094.1.37143 XP_004038861.1.27298 ENSP00000379110 ENSP00000379110 ENSPTRP00000027773 gi|4504153|ref|NP_001502.1| ENSP00000379110 ENSPTRP00000027773 ENSGGOP00000003299 9606.ENSP00000379110 ENSGGOP00000003299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]