SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003310 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003310
Domain Number 1 Region: 185-260
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-20
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000201
Family LASP-1 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003310
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000254
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003310   Gene: ENSGGOG00000003369   Transcript: ENSGGOT00000003385
Sequence length 261
Comment pep:known_by_projection chromosome:gorGor3.1:5:45254922:45307743:-1 gene:ENSGGOG00000003369 transcript:ENSGGOT00000003385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDSSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA
QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM
YGTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences A0A2J8W9T4 G3QLF9 Q5R5W0
ENSGGOP00000003310 ENSGGOP00000003310 9600.ENSPPYP00000009551 NP_001126670.1.23681 XP_004041885.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]