SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003312 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003312
Domain Number 1 Region: 143-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-38
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 33-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.04e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00062
Further Details:      
 
Domain Number 3 Region: 333-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-32
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 1038-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-27
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 717-733,769-928
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.63e-21
Family Laminin G-like module 0.0099
Further Details:      
 
Domain Number 6 Region: 571-628
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000105
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003312   Gene: ENSGGOG00000003362   Transcript: ENSGGOT00000003387
Sequence length 1364
Comment pep:known_by_projection chromosome:gorGor3.1:5:41340885:41356344:-1 gene:ENSGGOG00000003362 transcript:ENSGGOT00000003387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMHLRLFCILLAAVSGAEGWGYYGCDEELVGPLYARSLGASSYYSLFTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
STFFGNVNESAVVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGFYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWMEYDQPLYVGKQQPRGKSEASFTSPSSKAACLVSRSLLSQVPVPSASEQASV
SLVPPGLCILFYSSSPLGSLSNYNTSSCLWLCLHIGGFFEPGTWMRYNLQSALRSAAREF
SHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVTGEEV
SFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTDGQPH
SINITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRYNTP
GFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEVPPEL
DPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEPKAAH
EYHPGSKPPLPTSGPAQVPTPTAAPNPGPRDQNLPQILEESRSE
Download sequence
Identical sequences ENSGGOP00000003312 ENSGGOP00000003312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]