SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003316 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003316
Domain Number 1 Region: 330-582
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-67
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 110-219
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0087
Further Details:      
 
Domain Number 3 Region: 258-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 224-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 46-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000883
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003316   Gene: ENSGGOG00000003371   Transcript: ENSGGOT00000003391
Sequence length 591
Comment pep:known_by_projection chromosome:gorGor3.1:4:119133161:119193006:-1 gene:ENSGGOG00000003371 transcript:ENSGGOT00000003391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLHVFLLFLCFCLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCI
CKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLRPGTKFLNNGTCTAEGKFSVSLKHGI
TDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTE
CLHVHCRGLETSLAECTFTKRRTMGYQDLADVVCYTQKADSPMNDFFQCVNGKYISQMKA
CDGINDCGDQSDELCCKACQGKSFHCKSGVCIPSQYQCNGEVDCITGEDEVGCEAARHPT
IQGIFCFIIEETEILTADMDAERRRIKSLLPKLSCGVKNRTHIRRKRIVGGKRAQLGDLP
WQMAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDRKRIVIEYV
ERIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACIPWSPYLFQPNDTCIVSGW
GREKDNERVFSLRWGEVKLISNCSKFYGNRFYEKEMECAGTHDGSIDACKGDSGGPLVCM
DANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV
Download sequence
Identical sequences ENSGGOP00000003316 ENSGGOP00000003316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]