SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003364 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003364
Domain Number 1 Region: 17-109,252-473
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.65e-110
Family Bacterial dinuclear zinc exopeptidases 0.0013
Further Details:      
 
Domain Number 2 Region: 110-252
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.84e-36
Family Aminopeptidase/glucanase lid domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003364   Gene: ENSGGOG00000003423   Transcript: ENSGGOT00000003440
Sequence length 485
Comment pep:known_by_projection chromosome:gorGor3.1:2b:108338568:108353829:-1 gene:ENSGGOG00000003423 transcript:ENSGGOT00000003440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGHSPTRGAMQVAMNGKARQEAVQTAAKELLKFVNRSPSPFHAVAECRNRLLQAGFSEL
KETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQ
VGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIH
LQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAADERHHSVLMSLLCAHLGL
SPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEP
HVRMITLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHA
VHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRND
TPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSH
NLLVD
Download sequence
Identical sequences ENSGGOP00000003364 ENSGGOP00000003364 XP_004033307.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]