SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000003367
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00942
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003367   Gene: ENSGGOG00000003427   Transcript: ENSGGOT00000003444
Sequence length 250
Comment pep:known_by_projection chromosome:gorGor3.1:16:56514727:56579069:1 gene:ENSGGOG00000003427 transcript:ENSGGOT00000003444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQR
HRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSHRMRYACSSSEDWPPPLDISSD
GDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHS
PGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPGPGPRGSQGSPTPTR
APASGPERIV
Download sequence
Identical sequences ENSGGOP00000003367 ENSGGOP00000003367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]