SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003382 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003382
Domain Number 1 Region: 576-772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-46
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 512-605
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 296-357
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2-38
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000843
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003382
Domain Number - Region: 205-240
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00293
Family TFIIH p44 subunit cysteine-rich domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003382   Gene: ENSGGOG00000003439   Transcript: ENSGGOT00000003459
Sequence length 783
Comment pep:known_by_projection chromosome:gorGor3.1:1:211353263:211407168:1 gene:ENSGGOG00000003439 transcript:ENSGGOT00000003459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAG
AAAAASLEHDAAAGPACSGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLK
SPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNR
LLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHP
SRGPFAKHRLVQPPPPPPAPAEAASGPTGAAQGAPSGGGGCKSPGGAGAGATGGSTARKF
PTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSD
KAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKL
KMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALE
PKVSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFT
HSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTV
VLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRY
DNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVG
VLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKL
SGN
Download sequence
Identical sequences G3QLM3
ENSGGOP00000003382 XP_004028623.1.27298 ENSGGOP00000003382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]