SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003391
Domain Number 1 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 78-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000454
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003391   Gene: ENSGGOG00000003453   Transcript: ENSGGOT00000003468
Sequence length 188
Comment pep:known_by_projection chromosome:gorGor3.1:3:47815793:47819048:1 gene:ENSGGOG00000003453 transcript:ENSGGOT00000003468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCRKMARFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI
CLSIQSYY
Download sequence
Identical sequences G3QLN2
XP_004034074.1.27298 ENSGGOP00000003391 ENSGGOP00000003391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]