SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003395
Domain Number 1 Region: 115-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-46
Family Galectin (animal S-lectin) 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003395   Gene: ENSGGOG00000003457   Transcript: ENSGGOT00000003472
Sequence length 250
Comment pep:known_by_projection chromosome:gorGor3.1:14:35960724:35969270:1 gene:ENSGGOG00000003457 transcript:ENSGGOT00000003472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQRSAPGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYNMI
Download sequence
Identical sequences A0A2I2ZBI3
ENSGGOP00000003395 XP_004055252.1.27298 ENSGGOP00000003395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]