SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003406 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000003406
Domain Number - Region: 59-65,147-185
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0256
Family Formin homology 2 domain (FH2 domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003406   Gene: ENSGGOG00000003464   Transcript: ENSGGOT00000003483
Sequence length 642
Comment pep:novel chromosome:gorGor3.1:10:92783948:92792644:1 gene:ENSGGOG00000003464 transcript:ENSGGOT00000003483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLTQAPLVWQAPGALCGGVVCPPPLLLAAAPVVPVMATQVVGGTQACEGGWSQGLPLPP
PPPPPAAQLPPIVSQGNAGPWPQGAHGEGSLASSQAKAPPDDSCNPRSVYENFRLWQHYK
PLARRHLPQSPDTEALSCFLIPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYE
MAEKFPEFEAEEEMQIQKSQWMKGPQCLPPPATPRLEPQGPPAPEVVKQPVYLPSKAGPK
APTACLPPPRPQRPETKARLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGPSLGAT
GEPEKQREEGEVKQPQEEDWTPPDPGLLSYIDKLCSQKDFVTKVAVIHHQFLEELLSPDP
QMDFLALSQELEQEEGLTLAQLVEKRLLPLKEKQHARAAPSHGTARLDSSSSKFAAGQGA
ERDVPDPQQGDGMETCPPQTTARDSQGRGRAHTGMARSKDSVVLLGCQDSPGLRAAQPTS
PPQDHRPTCPGVGTKDALDLPGGPPVRESHGLAQGSSEEEELPSLAFLLGSQHKLLPWWL
PQSPVPASGLLSPEKWGPQGTHQSPSAERRGLNLAPCPANKPKKRPLFGSLSPAEKTPHP
GPGLRVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQHCSQ
Download sequence
Identical sequences ENSGGOP00000003406 ENSGGOP00000003406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]