SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003414 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000003414
Domain Number - Region: 104-159
Classification Level Classification E-value
Superfamily STAT 0.0863
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003414   Gene: ENSGGOG00000003473   Transcript: ENSGGOT00000003491
Sequence length 281
Comment pep:known_by_projection chromosome:gorGor3.1:1:192840245:192895051:-1 gene:ENSGGOG00000003473 transcript:ENSGGOT00000003491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKL
GDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIV
DLATKRKQYPRKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETV
AKEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCYRKPDAKPENFITQIE
TTPTETASRKTSDVVLKRKQTKDCPQRKWYPLRPKKINLDT
Download sequence
Identical sequences ENSGGOP00000003414 ENSGGOP00000003414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]