SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003434 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003434
Domain Number 1 Region: 283-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-48
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 18-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000519
Family LIM domain 0.00045
Further Details:      
 
Domain Number 3 Region: 130-222
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000223
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 75-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000228
Family LIM domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003434   Gene: ENSGGOG00000003489   Transcript: ENSGGOT00000003511
Sequence length 620
Comment pep:known_by_projection chromosome:gorGor3.1:22:15394308:15424308:1 gene:ENSGGOG00000003489 transcript:ENSGGOT00000003511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYLSVPAYFTSRDLFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEFCHGCSLLMTG
PFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTES
VQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPG
DRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAG
HPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSY
SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMR
SLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMFG
STLGSLCFKFLGLESGKRFFKQDKTVVVADFGLSRLIVEERKRHPMEKATTKKRTLRKND
RKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEVSSGTKAMPEAAGRARDCSCG
CLASSWAKCSPSQFPSKWFPDRETCCITSFPSRPAFSKLEDSFEALSLYLGELGIPLPAE
LEELDHTVSMQYGLTRDSPP
Download sequence
Identical sequences ENSGGOP00000003434 ENSGGOP00000003434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]