SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003438 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003438
Domain Number 1 Region: 1028-1365
Classification Level Classification E-value
Superfamily NHL repeat 7.06e-24
Family NHL repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 1263-1499
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000085
Family SGL-like 0.045
Further Details:      
 
Domain Number 3 Region: 466-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000381
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003438
Domain Number - Region: 724-796
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000106
Family Carboxypeptidase regulatory domain 0.037
Further Details:      
 
Domain Number - Region: 532-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 435-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 564-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 400-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 597-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 370-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0328
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 1933-2031,2123-2183
Classification Level Classification E-value
Superfamily NHL repeat 0.0759
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003438   Gene: ENSGGOG00000003488   Transcript: ENSGGOT00000003515
Sequence length 2567
Comment pep:known_by_projection chromosome:gorGor3.1:X:121711668:122315112:-1 gene:ENSGGOG00000003488 transcript:ENSGGOT00000003515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAQAGSTQDVQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSP
AAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYS
PPPRPLPRSTFSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQL
QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKALKLVFQKGRAIDTGEVDIG
AQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDG
KQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTA
IEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWK
GPECDVPEEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECH
CSTGWGGVNCETPLPVCQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELCTMECGSHGVC
SRGICQCEEGWVGPTCEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGC
PGLCFGNGRCTLDQNGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQ
SNCYISPLCQGSPDPLDLIQQSQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRR
ACVIRGQVVAIDGTPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFL
PEKRTLWLPWNQFIVVEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTAFGGSCPERGT
IVPELQVVQEEIPIPSSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGR
LTQKWFPAAINLVYTFAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVILQG
FEMDASNLGGWSLNKHHILNPQSGIIHKGNGENMFISQQPPVISTVMGNGHQRSVACTNC
NGPAHNNKLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSISILELRNRDTRHSTSPAHK
YYLAMDPVSESLYLSDTNTRKVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGG
RASEASLNSPRGITVDRHGFIYFVDGTMIRKIDENAVITTVIGSNGLTSTQPLSCDSGMD
ITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSK
VAIHSTLESARAISVSHSGLLFIAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPN
CDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNIYEIAS
PADQELYQFTVNGTHLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPL
WLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPE
GHLTNATFPTGEVSSFHSDLEKLTKVELDTSNRENALMSTNLTATSTIYILKQENTQSTY
RVNPDGSLRVTFASGMEIGLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQN
KGNVSAFERRLRAHNRNLLSIDFDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRY
NEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQ
RRYIFEYDQPDCLLSVTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQ
TLHLGTGRRVLYKYTKQARLSEVLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQT
GPLIGRQIFRFSEEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFG
KFSVINYDLNQVITTTVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDI
RVGVDANITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDL
RDRITRLGEIQYKMDEDGFLRQRGNDIFEYNSNGLLQKAYNKASGWTMQYYYDGLGRRVA
SKSSLGQHLQFFYADLTNPIRVTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACD
NTGTPLAVFSSRGQVIKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDY
DVVAGRWTTPNHHIWKQLNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQL
HNVLPGFPKPELENLELTYELLRLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMT
PRYNDGRCLEGGKQPRFAAVPSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAH
YLENLHFTIEGRDTHYFIKLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRR
FADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGVRAWTE
GEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences ENSGGOP00000003438 ENSGGOP00000003438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]