SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003453 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003453
Domain Number 1 Region: 165-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-23
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 108-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 3 Region: 3-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000175
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 4 Region: 65-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000222
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003453   Gene: ENSGGOG00000012348   Transcript: ENSGGOT00000003530
Sequence length 230
Comment pep:known_by_projection chromosome:gorGor3.1:1:176574532:176581057:1 gene:ENSGGOG00000012348 transcript:ENSGGOT00000003530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPT
PKCLTVQIICNTGYRLQNNENNISCVERGWSTPPECRSTECKDSTGKCGPPPPIDNGDIT
SFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMEKYNIAL
RWTAKQKFYSRTGESVEFVCKHGYRLSSRSHTLRTTCWNGKLEYPTCVKR
Download sequence
Identical sequences ENSGGOP00000003453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]