SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003466 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003466
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000742
Family Complement control module/SCR domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003466   Gene: ENSGGOG00000003527   Transcript: ENSGGOT00000003543
Sequence length 274
Comment pep:known_by_projection chromosome:gorGor3.1:10:6190182:6198585:-1 gene:ENSGGOG00000003527 transcript:ENSGGOT00000003543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKYVSTCLGPLEFLIGFFCFAELCDDDPPEITHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
RPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGSAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQVQTEIAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQEWQRERPIH
Download sequence
Identical sequences ENSGGOP00000003466 ENSGGOP00000022837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]