SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003516 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003516
Domain Number 1 Region: 94-197
Classification Level Classification E-value
Superfamily TAFH domain-like 1.11e-39
Family TAFH domain-like 0.00000254
Further Details:      
 
Domain Number 2 Region: 485-526
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000014
Family MYND zinc finger 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003516   Gene: ENSGGOG00000003578   Transcript: ENSGGOT00000003596
Sequence length 585
Comment pep:known_by_projection chromosome:gorGor3.1:20:30955387:30993046:1 gene:ENSGGOG00000003578 transcript:ENSGGOT00000003596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALSNGINHSPPT
LNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGE
KVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQT
PSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKR
VCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRD
RHHSLGLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESD
REELNYWKRRYNENTELRKTGTELVSRQHSPGSADSLSNDSQREFNSRPGTGYVPVEFWK
KTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINE
QEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHSQGRPL
LPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNGL
Download sequence
Identical sequences ENSGGOP00000003516 ENSGGOP00000003516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]