SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003535 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003535
Domain Number 1 Region: 1-125,240-343,749-991
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-148
Family Calcium ATPase, transmembrane domain M 0.00000000000533
Further Details:      
 
Domain Number 2 Region: 356-598
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.24e-68
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00000000688
Further Details:      
 
Domain Number 3 Region: 583-748
Classification Level Classification E-value
Superfamily HAD-like 7.64e-44
Family Meta-cation ATPase, catalytic domain P 0.000000778
Further Details:      
 
Domain Number 4 Region: 131-237
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-28
Family Calcium ATPase, transduction domain A 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003535   Gene: ENSGGOG00000003592   Transcript: ENSGGOT00000003615
Sequence length 1042
Comment pep:known_by_projection chromosome:gorGor3.1:12:109778591:109847987:1 gene:ENSGGOG00000003592 transcript:ENSGGOT00000003615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFRQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVL
LIMPLVIWVYSTDTNFSDMFWS
Download sequence
Identical sequences A0A2I2YDK6 A0A2J8XL94
ENSGGOP00000003535 ENSGGOP00000003535 XP_018894320.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]