SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003539 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003539
Domain Number 1 Region: 691-871
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 281-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.87e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 497-687
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-34
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 87-261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 904-1057
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-28
Family Laminin G-like module 0.00000309
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003539
Domain Number - Region: 9-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.011
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003539   Gene: ENSGGOG00000003597   Transcript: ENSGGOT00000003619
Sequence length 1482
Comment pep:known_by_projection chromosome:gorGor3.1:11:61430354:61541580:-1 gene:ENSGGOG00000003597 transcript:ENSGGOT00000003619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLCSPAGIPPCSSGGLCTVLAPGEVGCDCSHTGFGGKFCSEGESHPFQGPAHLTLNSEVG
SLLFSEGGAGRGGAGDVYQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTL
QRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNAWHDVRVTRN
LRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGS
PVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPE
AFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSSAQRADYFAMELLDG
HLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILD
LESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRSLAEAQGAVG
VAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVCEREATVLSYDGSMYM
KIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRV
GCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHTRLEFHNIE
TGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELNARFGLRAIVADPVT
FKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDL
GNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYI
GGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQVERGCDGPSTTCT
EESCANQGVCLQQWDGFTCDCTMTSYGGPICNDPGTTYIFGKGGALITYTWPPNDRPSTR
MDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVS
DGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLD
KEGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV
GEGPSVLLSAETTATTLLADMRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPS
TGGELILPIITEDSLDPPPVATRSPFVPPPPTFYPFLTGVGATQDTCQAERDDSDCEEPI
EASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVL
FAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLP
TANPTGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQV
DQSRNYISNSAQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSGGOP00000003539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]