SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003567 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003567
Domain Number 1 Region: 52-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000614
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 81-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000178
Family LIM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003567   Gene: ENSGGOG00000003629   Transcript: ENSGGOT00000003647
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:9:110061132:110148144:1 gene:ENSGGOG00000003629 transcript:ENSGGOT00000003647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIATGPESLERCFSRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQ
RPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQVLSSRMEGMMAS
YTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSIFHDIDSDTSLTSL
SDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
Download sequence
Identical sequences ENSGGOP00000003567 ENSGGOP00000003567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]