SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003572 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003572
Domain Number 1 Region: 197-301
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 18-123
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 302-407
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 4 Region: 768-876
Classification Level Classification E-value
Superfamily SRCR-like 9.29e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000975
Further Details:      
 
Domain Number 5 Region: 464-570
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003572   Gene: ENSGGOG00000003632   Transcript: ENSGGOT00000003652
Sequence length 992
Comment pep:known_by_projection chromosome:gorGor3.1:19:53002480:53028503:1 gene:ENSGGOG00000003632 transcript:ENSGGOT00000003652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQ
LGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCA
GQRVANSRDDSTSPLDGAPWPGLLVELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQA
KSTRAPLLTTGAPRQERLRLVSGPHRCTGRLEVWHGGRWGTVCDDGWDLRDAAVACRELG
CGGALAAPGGARFGPGAGPVWMDDVGCGGGEQTLRDCPRSPWGRSNCDHSEDAGLVCTGP
APRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPVGAFFG
EGSGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSN
DSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRL
EVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPRQPDPAAGRFGWGAGPIWLDDVGCVGT
EASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGEL
ATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRSTTQPPVMPTTKHSRAQSPPDL
TSQTTTALTTEASRRPTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQG
PQEMTSESTIKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNR
CAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMG
CKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSTEDLAKGTTTA
GVPGHTLPWSTTRRPGSSSPATRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTVGKLGP
TLGAGTTRSPGSPPTPRVHGDTDSPLEPLPQK
Download sequence
Identical sequences ENSGGOP00000003572 ENSGGOP00000003572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]