SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003615 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003615
Domain Number 1 Region: 126-367,395-477
Classification Level Classification E-value
Superfamily DNase I-like 6.54e-37
Family DNase I-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003615
Domain Number - Region: 37-83
Classification Level Classification E-value
Superfamily L domain-like 0.000235
Family Ngr ectodomain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003615   Gene: ENSGGOG00000003675   Transcript: ENSGGOT00000003697
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:5:165117976:165167026:1 gene:ENSGGOG00000003675 transcript:ENSGGOT00000003697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISELHLNNNLLRVLPFELGKLFQLQ
TLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRT
RPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVET
EQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFN
QLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMH
WDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVE
YLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYTNYT
FDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLELLLP
FLPQVNGIHLPGRR
Download sequence
Identical sequences ENSGGOP00000003615 ENSGGOP00000003615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]