SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003637 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003637
Domain Number 1 Region: 156-353
Classification Level Classification E-value
Superfamily E set domains 9.33e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000262
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-22
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003637   Gene: ENSGGOG00000003700   Transcript: ENSGGOT00000003720
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:11:17605491:17606663:-1 gene:ENSGGOG00000003700 transcript:ENSGGOT00000003720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSELHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
Download sequence
Identical sequences G3QMA2
ENSGGOP00000003637 ENSGGOP00000003637 XP_018891267.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]